PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G116600.1
Common NameB456_008G116600, LOC105762426
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARR-B
Protein Properties Length: 315aa    MW: 35313.5 Da    PI: 7.3256
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G116600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like69.36.3e-22198250155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kp+l Wt+eLH+rF++a++ L Gse A Pk+il+lm+v+gL  e+v SHLQk+Rl
  Gorai.008G116600.1 198 KPKLIWTNELHNRFLQAIDML-GSE-AYPKKILQLMNVPGLRKENVSSHLQKHRL 250
                         79*******************.665.9***************************8 PP

2Response_reg523.9e-18181261109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHH..HHHHESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealell..kekdpDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl+vd + +   +l ++l++ gy +v +++ +++al ++  +++++Dl+l+   + +md +ell++ir+ + +lpiiv+++  + + +l  
  Gorai.008G116600.1  18 VLLVDGDSTCVIILSKMLRSFGY-KVVTTKRATDALCIIrdQQHKIDLVLTEACLHDMDKYELLETIRNIS-SLPIIVMSTDYDRNAVLGS 106
                         89*********************.***************555555************************99.******************* PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         l  Ga  +l+Kp+ ++++ +
  Gorai.008G116600.1 107 LFKGAALHLEKPITMDDIKN 126
                         ***************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23002.3E-2315139No hitNo description
SuperFamilySSF521722.42E-2215132IPR011006CheY-like superfamily
SMARTSM004481.5E-1216128IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011027.36617132IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.0E-1318126IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.82E-1519132No hitNo description
SuperFamilySSF466893.05E-15195254IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-22197254IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-19198250IPR006447Myb domain, plants
PfamPF002491.3E-5203249IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MAISVESNMN NVYAGVTVLL VDGDSTCVII LSKMLRSFGY KVVTTKRATD ALCIIRDQQH  60
KIDLVLTEAC LHDMDKYELL ETIRNISSLP IIVMSTDYDR NAVLGSLFKG AALHLEKPIT  120
MDDIKNLWQF TLIKGREINV PIIEAKSCIK EVSSMESALG VVVDGRRNLR DEKRKRPLEV  180
ENDKEGDNWD QGSSTLKKPK LIWTNELHNR FLQAIDMLGS EAYPKKILQL MNVPGLRKEN  240
VSSHLQKHRL SLKRQQEAIL NTISSTESQA ASHHALSEFS PRNGFHLFTD TTQTTSVAEQ  300
HGYINGLVQD NLNG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-18197254462ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012435685.10.0PREDICTED: two-component response regulator ARR1-like
TrEMBLA0A0D2U1H90.0A0A0D2U1H9_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1721079
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.14e-55response regulator 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]